PDB entry 1bap

View 1bap on RCSB PDB site
Description: a pro to gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity: sugar-binding and crystallographic studies
Class: binding proteins
Keywords: binding proteins
Deposited on 1991-11-15, released 1992-01-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.75 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arabinose-binding protein
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02924 (Start-305)
      • conflict (253)
    Domains in SCOP 1.73: d1bapa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bapA (A:)
    enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
    fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqe
    lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
    gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
    skaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
    kglggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bapA (A:)
    nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
    victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
    ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
    afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
    kaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
    glggk