PDB entry 1bak

View 1bak on RCSB PDB site
Description: signal transduction pleckstrin homology domain of g-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1), c-terminal extended, nmr, 20 structures
Class: transferase
Keywords: pleckstrin homology domain, ph domain, signal transduction, g-beta-gamma binding domain, beta-adrenergic receptor kinase, beta-ark, g-protein coupled receptor kinase (grk-2), transferase
Deposited on 1997-11-21, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g-protein coupled receptor kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1baka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bakA (A:)
    gshmgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsvee
    tqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkprs