PDB entry 1ba9

View 1ba9 on RCSB PDB site
Description: the solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures
Deposited on 1998-04-24, released 1998-09-16
The last revision prior to the SCOP 1.61 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: NMR36
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ba9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ba9_ (-)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneqstktgnagsrlacgvigiaq