PDB entry 1b9y

View 1b9y on RCSB PDB site
Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma
Class: signaling protein
Keywords: phosducin, transducin, beta-gamma, signal transduction, regulation, phosphorylation, g proteins, thioredoxin, vision, meka, complex (transducer/ transduction), signaling protein
Deposited on 1999-02-16, released 1999-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transducin)
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62871 (0-339)
      • conflict (70)
    Domains in SCOPe 2.06: d1b9ya_
  • Chain 'B':
    Compound: protein (transducin)
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b9yb_
  • Chain 'C':
    Compound: protein (phosducin)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RAT PDC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b9yc_
  • Heterogens: GD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9yA (A:)
    mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
    mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
    csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
    tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
    fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
    kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9yB (B:)
    mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
    knpfkelk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b9yC (C:)
    meeaasqsleedfegqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrd
    dkdskermsrkmsiqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletg
    eqfletiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdr
    fssdvlptllvykggelisnfisvaeqfaedffaadvesflneygllpereihdlgqtnt
    ededie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9yC (C:)
    egqathtgpkgvindwrkfklesegclrkyrrqcmqdmhqklsfgprygfvyeletgeqf
    letiekeqkvttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfss
    dvlptllvykggelisnfisvaeqfaedffaadvesflneygllper