PDB entry 1b9w

View 1b9w on RCSB PDB site
Description: c-terminal merozoite surface protein 1 from plasmodium cynomolgi
Class: surface protein
Keywords: msp-1, candidate malaria vaccine, surface antigen, surface protein
Deposited on 1999-02-15, released 1999-05-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (merozoite surface protein 1)
    Species: Plasmodium cynomolgi, synthetic [TaxId:5827]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1b9wa1, d1b9wa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9wA (A:)
    mssehrcidtnvpenaacyryldgteewrcllyfkedagkcvpapnmtckdknggcapea
    eckmndkneivckctkegseplfegvfcshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9wA (A:)
    mssehrcidtnvpenaacyryldgteewrcllyfkedagkcvpapnmtckdknggcapea
    eckmndkneivckctkegseplfegvfcshh