PDB entry 1b9a

View 1b9a on RCSB PDB site
Description: parvalbumin (mutation;d51a, f102w)
Class: calcium binding protein
Keywords: calcium binding protein, ef-hand proteins, parvalbumin, calcium-binding
Deposited on 1999-02-10, released 1999-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (parvalbumin)
  Species: Cyprinus carpio
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02618 (0-107)
  Domains in SCOP 1.75: d1b9aa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b9aA (A:)
  afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
  delklflqnfkadaraltdgetktflkagdsdgdgkigvdewtalvka