PDB entry 1b9a

View 1b9a on RCSB PDB site
Description: parvalbumin (mutation;d51a, f102w)
Deposited on 1999-02-10, released 1999-02-15
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-18, with a file datestamp of 1999-10-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1b9aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9aA (A:)
    afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
    delklflqnfkadaraltdgetktflkagdsdgdgkigvdewtalvka