PDB entry 1b8x

View 1b8x on RCSB PDB site
Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1
Deposited on 1999-02-03, released 1999-04-12
The last revision prior to the SCOP 1.61 freeze date was dated 1999-04-12, with a file datestamp of 1999-04-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8xA (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaf
    tysptpvtsgigigmsamgs