PDB entry 1b8r

View 1b8r on RCSB PDB site
Description: parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein, ef-hand proteins, parvalbumin, calcium-binding
Deposited on 1999-02-02, released 1999-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (parvalbumin)
  Species: Cyprinus carpio [TaxId:7962]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02618 (0-107)
  Domains in SCOPe 2.07: d1b8ra_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b8rA (A:)
  afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiidqdksgfiee
  delklflqnfkadaraltdgetktflkagdsdgdgkigvdewtalvka