PDB entry 1b8r

View 1b8r on RCSB PDB site
Description: parvalbumin
Deposited on 1999-02-02, released 1999-02-09
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-05, with a file datestamp of 1999-10-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1b8ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8rA (A:)
    afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiidqdksgfiee
    delklflqnfkadaraltdgetktflkagdsdgdgkigvdewtalvka