PDB entry 1b8l

View 1b8l on RCSB PDB site
Description: calcium-bound d51a/e101d/f102w triple mutant of beta carp parvalbumin
Deposited on 1999-02-01, released 1999-10-05
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-05, with a file datestamp of 1999-10-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1b8la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8lA (A:)
    afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
    delklflqnfkadaraltdgetktflkagdsdgdgkigvddwtalvka