PDB entry 1b88

View 1b88 on RCSB PDB site
Description: v-alpha 2.6 mouse t cell receptor (tcr) domain
Deposited on 1999-02-09, released 1999-02-16
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1b88a_
  • Chain 'B':
    Domains in SCOP 1.65: d1b88b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b88A (A:)
    mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
    rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b88B (B:)
    mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
    rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp