PDB entry 1b88

View 1b88 on RCSB PDB site
Description: v-alpha 2.6 mouse t cell receptor (tcr) domain
Class: immune system
Keywords: t cell receptor, MHC class I, human immunodeficiency virus, molecular recognition, immune system
Deposited on 1999-02-09, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t cell receptor v-alpha domain
  Species: Mus musculus [TaxId:10090]
  Gene: TCRAV2S6J38
  Database cross-references and differences (RAF-indexed):
  • GB U63546
  Domains in SCOPe 2.08: d1b88a_
• Chain 'B':
  Compound: t cell receptor v-alpha domain
  Species: Mus musculus [TaxId:10090]
  Gene: TCRAV2S6J38
  Database cross-references and differences (RAF-indexed):
  • GB U63546 (0-113)
  Domains in SCOPe 2.08: d1b88b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b88A (A:)
  mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
  rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b88B (B:)
  mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
  rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp