PDB entry 1b7v

View 1b7v on RCSB PDB site
Description: structure of the c-553 cytochrome from bacillus pasteurii to 1.7 a resolution
Class: electron transfer
Keywords: cytochrome, electron transfer
Deposited on 1999-01-22, released 2000-03-27
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytochrome c-553)
    Species: Bacillus pasteurii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b7va_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b7vA (A:)
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk