PDB entry 1b7p

View 1b7p on RCSB PDB site
Description: verification of spmp using mutant human lysozymes
Class: hydrolase
Keywords: mutant stability, human lysozyme
Deposited on 1998-05-08, released 1999-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 1999-12-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (77)
    Domains in SCOP 1.73: d1b7pa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7pA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnacglscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv