PDB entry 1b6u

View 1b6u on RCSB PDB site
Description:
Deposited on 1999-01-18, released 1999-01-27
The last revision prior to the SCOP 1.69 freeze date was dated 1999-04-06, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1b6u_1, d1b6u_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1b6u_ (-)
    hegvhrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvs
    kanfsigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvla
    gesvtlscssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgs
    frdspyewsnssdpllvsvtgnpsnswpsptepssetgnprhlhaaaeqkliseedlnld
    lvprgssshhhhhhssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6u_ (-)
    hrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvskanf
    sigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlagesv
    tlscssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgsfrds
    pyewsnssdpllvsvtgnp