PDB entry 1b6u

View 1b6u on RCSB PDB site
Description: crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles
Deposited on 1999-01-18, released 1999-01-27
The last revision prior to the SCOP 1.59 freeze date was dated 1999-04-06, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b6u_ (-)
hrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvskanf
sigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlagesv
tlscssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgsfrds
pyewsnssdpllvsvtgnp