PDB entry 1b6n

View 1b6n on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 3
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1b6na_
  • Chain 'B':
    Domains in SCOP 1.71: d1b6nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b6nA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b6nB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf