PDB entry 1b6m

View 1b6m on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 6
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1b6ma_
  • Chain 'B':
    Domains in SCOP 1.71: d1b6mb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6mA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6mB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf