PDB entry 1b6j

View 1b6j on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 1
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b6ja_
  • Chain 'B':
    Domains in SCOP 1.55: d1b6jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6jA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6jA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b6jB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6jB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf