PDB entry 1b6j

View 1b6j on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 1
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase-peptide), hydrolase-hydrolase inhibitor complex
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369
      • see remark 999 (66)
      • see remark 999 (94)
      • see remark 999 (40)
      • see remark 999 (42)
      • see remark 999 (44)
      • see remark 999 (69)
    Domains in SCOPe 2.07: d1b6ja_
  • Chain 'B':
    Compound: retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • see remark 999 (66)
      • see remark 999 (94)
      • see remark 999 (40)
      • see remark 999 (42)
    Domains in SCOPe 2.07: d1b6jb_
  • Chain 'C':
    Compound: cyclic peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1B6J (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6jA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6jB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'C':
    No sequence available.