PDB entry 1b6i

View 1b6i on RCSB PDB site
Description: t4 lysozyme mutant with cys 54 replaced by thr, cys 97 replaced by ala, thr 21 replaced by cys and lys 124 replaced by cys (c54t,c97a, t21c,k124c)
Deposited on 1999-01-14, released 2000-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1b6ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b6iA (A:)
  mnifemlrideglrlkiykdcegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
  lqqcrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk