PDB entry 1b6f

View 1b6f on RCSB PDB site
Description: birch pollen allergen bet v 1
Class: plant protein
Keywords: major birch pollen allergen, pathogenesis-related protein, nmr structure, plant protein
Deposited on 1999-01-13, released 2000-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (major pollen allergen bet v 1-a)
    Species: Betula pendula, synthetic [TaxId:3505]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered (138)
    Domains in SCOPe 2.07: d1b6fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6fA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskelgetllravesyllahsdayn