PDB entry 1b6e

View 1b6e on RCSB PDB site
Description: human cd94
Class: nk cell
Keywords: nk cell, receptor, c-type lectin, c-type lectin-like, nkd
Deposited on 1999-01-14, released 1999-06-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd94
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1b6ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6eA (A:)
    lqkdsdccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsss
    qqfywiglsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknr
    yickqqli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6eA (A:)
    cscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfywig
    lsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickqql
    i