PDB entry 1b6d

View 1b6d on RCSB PDB site
Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer
Deposited on 1999-01-13, released 1999-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6dA (A:)
    diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
    rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6dB (B:)
    diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
    rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg