PDB entry 1b63

View 1b63 on RCSB PDB site
Description: mutl complexed with adpnp
Deposited on 1999-01-20, released 1999-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b63A (A:)
    shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
    ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
    eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
    alarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrg
    wvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphq
    vdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq