PDB entry 1b62

View 1b62 on RCSB PDB site
Description: mutl complexed with adp
Deposited on 1999-01-11, released 1999-04-28
The last revision prior to the SCOP 1.69 freeze date was dated 1999-04-28, with a file datestamp of 1999-04-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.231
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b62A (A:)
    mpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirirdng
    cgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqqea
    wqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirrial
    arfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrgwv
    adpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphqvd
    vnvhpakhevrfhqsrlvhdfiyqgvlsvlqqqletplplddepqpapr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b62A (A:)
    mpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirirdng
    cgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqqea
    wqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirrial
    arfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrgwv
    adpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphqvd
    vnvhpkhevrfhqsrlvhdfiyqgvlsvlqq