PDB entry 1b48

View 1b48 on RCSB PDB site
Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4
Deposited on 1999-01-06, released 1999-09-29
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-29, with a file datestamp of 1999-09-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b48A (A:)
    aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid
    gmmltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesy
    dlilsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpll
    qafktrisniptikkflqpgsqrkpppdgpyvevvrivlkf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b48B (B:)
    aakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveid
    gmmltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesy
    dlilsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpll
    qafktrisniptikkflqpgsqrkpppdgpyvevvrivlkf