PDB entry 1b3m

View 1b3m on RCSB PDB site
Description: monomeric sarcosine oxidase from bacillus sp. b-0618
Deposited on 1998-12-12, released 2000-02-18
The last revision prior to the SCOP 1.59 freeze date was dated 2000-02-18, with a file datestamp of 2000-02-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3mA (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldipqlpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3mB (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldipqlpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq