PDB entry 1b3j

View 1b3j on RCSB PDB site
Description: structure of the MHC class I homolog mic-a, a gammadelta t cell ligand
Class: immune system
Keywords: hc I homolog, human mica, mica, immunology, MHC, gamma-delta-tcr, glycoprotein, signa immunoglobulin fold, T-cell, immune system
Deposited on 1998-12-11, released 1999-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.246
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I homolog mic-a
    Species: Homo sapiens [TaxId:9606]
    Gene: MICA-001
    Database cross-references and differences (RAF-indexed):
    • GB U56940 (0-273)
    Domains in SCOPe 2.07: d1b3ja1, d1b3ja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3jA (A:)
    ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
    retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
    nletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlrr
    tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
    yqtwvatricqgeeqrftcymehsgnhsthpvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3jA (A:)
    ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
    retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
    nletkewtmpqssraqtlamnvrnflkedamadclqelrrylksgvvlrrtvppmvnvtr
    seasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngtyqtwvatric
    qgeeqrftcymehsgnhsthpvps