PDB entry 1b3b

View 1b3b on RCSB PDB site
Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k
Deposited on 1998-12-07, released 1999-12-08
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-08, with a file datestamp of 1999-12-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.225
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3bA (A:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3bB (B:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3bC (C:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3bD (D:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3bE (E:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3bF (F:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg