PDB entry 1b33

View 1b33 on RCSB PDB site
Description: structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Class: photosynthesis
Keywords: light-harvesting protein, cyanobacteria, allophycocyanin, linker polypeptides, complex structure
Deposited on 1998-12-15, released 1999-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allophycocyanin, alpha chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33a_
  • Chain 'B':
    Compound: allophycocyanin, beta chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00318 (0-160)
      • methylated asn (70)
    Domains in SCOP 1.75: d1b33b_
  • Chain 'C':
    Compound: allophycocyanin, alpha chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33c_
  • Chain 'D':
    Compound: allophycocyanin, beta chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00318 (0-160)
      • methylated asn (70)
    Domains in SCOP 1.75: d1b33d_
  • Chain 'E':
    Compound: allophycocyanin, alpha chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33e_
  • Chain 'F':
    Compound: allophycocyanin, beta chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00318 (0-160)
      • methylated asn (70)
    Domains in SCOP 1.75: d1b33f_
  • Chain 'H':
    Compound: allophycocyanin, alpha chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33h_
  • Chain 'I':
    Compound: allophycocyanin, beta chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00318 (0-160)
      • methylated asn (70)
    Domains in SCOP 1.75: d1b33i_
  • Chain 'J':
    Compound: allophycocyanin, alpha chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33j_
  • Chain 'K':
    Compound: allophycocyanin, beta chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00318 (0-160)
      • methylated asn (70)
    Domains in SCOP 1.75: d1b33k_
  • Chain 'L':
    Compound: allophycocyanin, alpha chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33l_
  • Chain 'M':
    Compound: allophycocyanin, beta chain
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00318 (0-160)
      • methylated asn (70)
    Domains in SCOP 1.75: d1b33m_
  • Chain 'N':
    Compound: phycobilisome 7.8 kd linker polypeptide
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33n_
  • Chain 'O':
    Compound: phycobilisome 7.8 kd linker polypeptide
    Species: Mastigocladus laminosus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b33o_
  • Heterogens: BLA, CYC, BO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33A (A:)
    sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
    rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
    pidavaagvsamknvassilsaedaaeagayfdyvagala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33B (B:)
    mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33C (C:)
    sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
    rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
    pidavaagvsamknvassilsaedaaeagayfdyvagala
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33D (D:)
    mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33E (E:)
    sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
    rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
    pidavaagvsamknvassilsaedaaeagayfdyvagala
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33F (F:)
    mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33H (H:)
    sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
    rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
    pidavaagvsamknvassilsaedaaeagayfdyvagala
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33I (I:)
    mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33J (J:)
    sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
    rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
    pidavaagvsamknvassilsaedaaeagayfdyvagala
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33K (K:)
    mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33L (L:)
    sivtksivnadaearylspgeldriksfvssgekrlriaqiltdnrerivkqagdqlfqk
    rpdvvspggnaygqemtatclrdldyylrlitygivagdvtpieeigivgvremykslgt
    pidavaagvsamknvassilsaedaaeagayfdyvagala
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33M (M:)
    mqdaitavinssdvqgkyldtaaleklksyfstgelrvraattiaanaaaivkeavaksl
    lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
    vpisatvqaiqamkevtaslvgpdagkemgvyfdyicsgls
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33N (N:)
    grlfkitacvpsqtrirtqrelqntyftklvpyenwfreqqriqkmggkivkvelatgkq
    gintgla
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b33O (O:)
    grlfkitacvpsqtrirtqrelqntyftklvpyenwfreqqriqkmggkivkvelatgkq
    gintgla