PDB entry 1b23

View 1b23 on RCSB PDB site
Description: E. coli cysteinyl-tRNA and T. aquaticus elongation factor EF-TU:GTP ternary complex
Class: gene regulation/RNA
Keywords: translation elongation factor, transfer RNA, protein synthesis, gene regulation-RNA complex
Deposited on 1998-12-04, released 1998-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: elongation factor tu
    Species: Thermus aquaticus [TaxId:271]
    Gene: TUFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1b23p1, d1b23p2, d1b23p3
  • Chain 'R':
    Compound: cysteinyl tRNA
    Species: Escherichia coli [TaxId:562]
  • Heterogens: MG, SO4, CYS, GNP, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b23P (P:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'R':
    No sequence available.