PDB entry 1b1z

View 1b1z on RCSB PDB site
Description: streptococcal pyrogenic exotoxin a1
Class: toxin
Keywords: superantigen, zinc binding, pyrogenic exotoxin
Deposited on 1998-11-24, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (toxin)
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b1za1, d1b1za2
  • Chain 'B':
    Compound: protein (toxin)
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b1zb1, d1b1zb2
  • Chain 'C':
    Compound: protein (toxin)
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b1zc1, d1b1zc2
  • Chain 'D':
    Compound: protein (toxin)
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b1zd1, d1b1zd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b1zA (A:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievylttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b1zA (A:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b1zB (B:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievylttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b1zB (B:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b1zC (C:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievylttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b1zC (C:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b1zD (D:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievylttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b1zD (D:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt