PDB entry 1b1i

View 1b1i on RCSB PDB site
Description: crystal structure of human angiogenin
Deposited on 1998-11-20, released 1999-04-02
The last revision prior to the SCOP 1.71 freeze date was dated 2000-03-20, with a file datestamp of 2000-03-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.222
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1b1ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1iA (A:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp