PDB entry 1b11

View 1b11 on RCSB PDB site
Description: structure of feline immunodeficiency virus protease complexed with tl-3-093
Class: hydrolase
Keywords: fiv protease, inhibitor, hydrolase
Deposited on 1998-11-25, released 1998-12-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Feline Immunodeficiency Virus PROTEASE)
    Species: Feline immunodeficiency virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1b11a_
  • Heterogens: SO4, INT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b11A (A:)
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm