PDB entry 1b0x

View 1b0x on RCSB PDB site
Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Deposited on 1998-11-14, released 1999-05-03
The last revision prior to the SCOP 1.57 freeze date was dated 1999-05-03, with a file datestamp of 1999-05-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1b0xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0xA (A:)
    fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
    qamrtqmqqmhg