PDB entry 1b0x

View 1b0x on RCSB PDB site
Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Deposited on 1998-11-14, released 1999-05-03
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-03, with a file datestamp of 1999-05-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1b0xa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b0xA (A:)
  fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
  qamrtqmqqmhg