PDB entry 1b0w
View 1b0w on RCSB PDB site
Description: Structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
Class: immune system
Keywords: immunoglobulin, amyloid, immune system
Deposited on
1998-11-13, released
1998-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-11-17, with a file datestamp of
2009-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: bence-jones kappa I protein bre
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1b0wa_ - Chain 'B':
Compound: bence-jones kappa I protein bre
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1b0wb_ - Chain 'C':
Compound: bence-jones kappa I protein bre
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1b0wc_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1b0wA (A:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1b0wB (B:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1b0wC (C:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr