PDB entry 1b0w

View 1b0w on RCSB PDB site
Description: structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
Deposited on 1998-11-13, released 1998-11-16
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1b0wa_
  • Chain 'B':
    Domains in SCOP 1.63: d1b0wb_
  • Chain 'C':
    Domains in SCOP 1.63: d1b0wc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b0wA (A:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b0wB (B:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b0wC (C:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr