PDB entry 1b0n

View 1b0n on RCSB PDB site
Description: sinr protein/sini protein complex
Deposited on 1998-11-11, released 1999-01-13
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-15, with a file datestamp of 1999-12-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0nA (A:)
    migqrikqyrkekgyslselaekagvaksylssiernlqtnpsiqflekvsavldvsvht
    lldekheteydgqldseweklvrdamtsgvskkqfrefldyqkwrksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0nA (A:)
    migqrikqyrkekgyslselaekagvaksylssiernlqtnpsiqflekvsavldvsvht
    lldekhetldseweklvrdamtsgvskkqfrefldyqkwrksq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0nB (B:)
    feldqewvelmveakeanispeeirkyllln