PDB entry 1b08

View 1b08 on RCSB PDB site
Description: lung surfactant protein d (sp-d) (fragment)
Class: sugar binding protein
Keywords: c-type lectin, crd, sp-d, colectin, alpha-helical coiled-coil, lung surfactant, sugar binding protein
Deposited on 1998-11-18, released 1999-11-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lung surfactant protein d)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b08a1, d1b08a2
  • Chain 'B':
    Compound: protein (lung surfactant protein d)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b08b1, d1b08b2
  • Chain 'C':
    Compound: protein (lung surfactant protein d)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b08c1, d1b08c2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b08A (A:)
    eaeagsvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpftea
    qllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnw
    apgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b08A (A:)
    vaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctq
    aggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepn
    ddggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b08B (B:)
    eaeagsvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpftea
    qllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnw
    apgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b08B (B:)
    aslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqa
    ggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnd
    dggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b08C (C:)
    eaeagsvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpftea
    qllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnw
    apgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b08C (C:)
    rqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqaggq
    lasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepnddgg
    sedcveiftngkwndracgekrlvvcef