PDB entry 1b07

View 1b07 on RCSB PDB site
Description: crk sh3 domain complexed with peptoid inhibitor
Deposited on 1998-11-17, released 1999-01-06
The last revision prior to the SCOP 1.59 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1b07a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b07A (A:)
    saeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky