PDB entry 1azu

View 1azu on RCSB PDB site
Description: structural features of azurin at 2.7 angstroms resolution
Deposited on 1980-08-04, released 1980-09-26
The last revision prior to the SCOP 1.55 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.35
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1azu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1azu_ (-)
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalmk
gtltlk