PDB entry 1azt

View 1azt on RCSB PDB site
Description: gs-alpha complexed with gtp-gamma-s
Deposited on 1997-11-20, released 1998-02-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aztA (A:)
    qvyrathrllllgagesgkstivkqmrilhvngfngdgekatkvqdiknnlkeaietiva
    amsnlvppvelanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersne
    yqlidcaqyfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqr
    derrkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvi
    lflnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflri
    stasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aztA (A:)
    qvyrathrllllgagesgkstivkqmrilhvkatkvqdiknnlkeaietivaamsnlvpp
    velanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaq
    yfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiq
    cfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdl
    laekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgr
    hycyphftcavdtenirrvfndcrdiiqrmhlrqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aztB (B:)
    qvyrathrllllgagesgkstivkqmrilhvngfngdgekatkvqdiknnlkeaietiva
    amsnlvppvelanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersne
    yqlidcaqyfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqr
    derrkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvi
    lflnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflri
    stasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aztB (B:)
    qvyrathrllllgagesgkstivkqmrilhvngfnekatkvqdiknnlkeaietivaams
    nlvppvelanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyql
    idcaqyfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrder
    rkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilfl
    nkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflrista
    sgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqy