PDB entry 1azt

View 1azt on RCSB PDB site
Description: gs-alpha complexed with GTP-gamma-s
Class: hydrolase
Keywords: hydrolase, signal transducing protein, GTP-binding protein
Deposited on 1997-11-20, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gs-alpha
    Species: Bos taurus [TaxId:9913]
    Gene: GNAS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azta1, d1azta2
  • Chain 'B':
    Compound: gs-alpha
    Species: Bos taurus [TaxId:9913]
    Gene: GNAS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aztb1, d1aztb2
  • Heterogens: MG, PO4, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aztA (A:)
    mgclgnsktedqrneekaqreankkiekqlqkdkqvyrathrllllgagesgkstivkqm
    rilhvngfngeggeedpqaarsnsdgekatkvqdiknnlkeaietivaamsnlvppvela
    npenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfld
    kidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfnd
    vtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllaek
    vlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhycy
    phftcavdtenirrvfndcrdiiqrmhlrqyellgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aztA (A:)
    qvyrathrllllgagesgkstivkqmrilhvkatkvqdiknnlkeaietivaamsnlvpp
    velanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaq
    yfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiq
    cfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdl
    laekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgr
    hycyphftcavdtenirrvfndcrdiiqrmhlrqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aztB (B:)
    mgclgnsktedqrneekaqreankkiekqlqkdkqvyrathrllllgagesgkstivkqm
    rilhvngfngeggeedpqaarsnsdgekatkvqdiknnlkeaietivaamsnlvppvela
    npenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfld
    kidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfnd
    vtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllaek
    vlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhycy
    phftcavdtenirrvfndcrdiiqrmhlrqyellgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aztB (B:)
    qvyrathrllllgagesgkstivkqmrilhvngfnekatkvqdiknnlkeaietivaams
    nlvppvelanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyql
    idcaqyfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrder
    rkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilfl
    nkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflrista
    sgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqy