PDB entry 1azs

View 1azs on RCSB PDB site
Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase
Class: complex (lyase/hydrolase)
Keywords: complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme
Deposited on 1997-11-20, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vc1
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: ADENYLYL CYCLASE TYPE V
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30803
      • engineered (120)
    Domains in SCOPe 2.07: d1azsa_
  • Chain 'B':
    Compound: iic2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ADENYLYL CYCLASE TYPE II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azsb_
  • Chain 'C':
    Compound: gs-alpha
    Species: Bos taurus [TaxId:9913]
    Gene: GNAS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azsc1, d1azsc2
  • Heterogens: MG, GSP, FKP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1azsA (A:)
    mhhhhhhamemkadinakqedmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmt
    lnelfarfdklaaenhclrikilgdcyycvsglpearadhahccvemgmdmieaislvre
    mtgvnvnmrvgihsgrvhcgvlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsy
    lngdyevepgcggernaylkehsietflilrctqkrkeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azsA (A:)
    dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri
    kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg
    vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk
    ehsietflil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1azsB (B:)
    rslkneelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskp
    kfsgvekiktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkh
    sfndfklrvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslil
    qtlgytctcrgiinvkgkgdlktyfvntemsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azsB (B:)
    hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
    tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
    vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
    dlktyfvnt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1azsC (C:)
    mgclgnsktedqrneekaqreankkiekqlqkdkqvyrathrllllgagesgkstivkqm
    rilhvngfngeggeedpqaarsnsdgekatkvqdiknnlkeaietivaamsnlvppvela
    npenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidcaqyfld
    kidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkwiqcfnd
    vtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkqdllaek
    vlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgdgrhycy
    phftcavdtenirrvfndcrdiiqrmhlrqyellgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azsC (C:)
    vyrathrllllgagesgkstivkqmrilhvngekatkvqdiknnlkeaietivaamsnlv
    ppvelanpenqfrvdyilsvmnvpdfdfppefyehakalwedegvracyersneyqlidc
    aqyfldkidvikqddyvpsdqdllrcrvltsgifetkfqvdkvnfhmfdvggqrderrkw
    iqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnkq
    dllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasgd
    grhycyphftcavdtenirrvfndcrdiiqrmhlrqyel