PDB entry 1ayv

View 1ayv on RCSB PDB site
Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent thiazolhydrazide inhibitor
Deposited on 1997-11-10, released 1998-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1ayv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ayv_ (-)
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm