PDB entry 1ayr

View 1ayr on RCSB PDB site
Description: arrestin from bovine rod outer segments
Class: sensory transduction
Keywords: sensory transduction, arrestin, rhodopsin
Deposited on 1997-11-10, released 1998-11-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.254
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arrestin
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ayra1, d1ayra2
  • Chain 'B':
    Compound: arrestin
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ayrb1, d1ayrb2
  • Chain 'C':
    Compound: arrestin
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ayrc1, d1ayrc2
  • Chain 'D':
    Compound: arrestin
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ayrd1, d1ayrd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayrA (A:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edpdtaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ayrB (B:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edpdtaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayrB (B:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayrC (C:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edpdtaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ayrD (D:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edpdtaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayrD (D:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edp