PDB entry 1ayr

View 1ayr on RCSB PDB site
Description: arrestin from bovine rod outer segments
Deposited on 1997-11-10, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.254
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayrA (A:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edpdtaka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayrB (B:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayrC (C:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edpdtaka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayrD (D:)
    mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
    ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
    tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
    prdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvl
    veqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkik
    hedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
    edp